General Information

  • ID:  hor000969
  • Uniprot ID:  Q9PU29
  • Protein name:  Cholecystokinin-8
  • Gene name:  CCK
  • Organism:  Struthio camelus (Common ostrich)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  Highly concentrated in the duodenum. Also localized in more distal parts of the small intestine.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Struthio (genus), Struthionidae (family), Struthioniformes (order), Palaeognathae (superorder), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region; GO:0030424 axon

Sequence Information

  • Sequence:  DYMGWMDF
  • Length:  8
  • Propeptide:  MYSGICICVFLAVLSASSFGQQTAGSHNGNPLAAELEQSLTEHHRHVRAPSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
  • Signal peptide:  MYSGICICVFLAVLSASSFG
  • Modification:  T2 Sulfotyrosine;T8 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 18 minute; /1080 seconds ( PubMed ID: 6291099 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9PU29-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000969_AF2.pdbhor000969_ESM.pdb

Physical Information

Mass: 118924 Formula: C49H61N9O14S2
Absent amino acids: ACEHIKLNPQRSTV Common amino acids: DM
pI: 3.49 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -37.5 Boman Index: -663
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 9927.5 Extinction Coefficient cystines: 6990
Absorbance 280nm: 998.57

Literature

  • PubMed ID:  11072120##6291099
  • Title:  Identification of ostrich and chicken cholecystokinin cDNA and intestinal peptides.